PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf02972g06009.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family Dof
Protein Properties Length: 260aa    MW: 28810.2 Da    PI: 6.5079
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf02972g06009.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof122.71.3e-3847108263
                    zf-Dof   2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkksss 63 
                               k++al+cprC+stntkfCyynnyslsqPryfCk+C+ryWt+GG+lr +P+Ggg+rk+kksss
  Niben101Scf02972g06009.1  47 KDQALNCPRCNSTNTKFCYYNNYSLSQPRYFCKTCKRYWTEGGSLRSIPIGGGSRKSKKSSS 108
                               7899******************************************************9875 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-233496IPR003851Zinc finger, Dof-type
PfamPF027011.3E-3348105IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.40751105IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105389IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MDTAQWPQEI VVKPMEEIIP KNTNTITTIC SSKPSKHIER KIKPHQKDQA LNCPRCNSTN  60
TKFCYYNNYS LSQPRYFCKT CKRYWTEGGS LRSIPIGGGS RKSKKSSSAN CSSSNSVLRE  120
LSKNAAAPGL APPKIEGSQD LNLGFSCDFK TISELIQVPN NSFMPMPISD PNSVYSSLNF  180
SLDYGLGIGG DYENNLQDVQ ESTTSGRLLF PFEDLKQVSN TSIDGPEENR DEEAESSDSL  240
LFWVRKGGPT NIPLGTRAEE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009788365.11e-146PREDICTED: dof zinc finger protein DOF1.8-like
RefseqXP_016478543.11e-146PREDICTED: dof zinc finger protein DOF1.8-like
SwissprotQ8LAP87e-48DOF46_ARATH; Dof zinc finger protein DOF4.6
TrEMBLA0A0B6VI931e-146A0A0B6VI93_TOBAC; Dof zinc finger protein
STRINGVIT_02s0025g02250.t012e-73(Vitis vinifera)
STRINGPGSC0003DMT4000319284e-73(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8824419
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24060.12e-39Dof family protein